Lineage for d3e6db1 (3e6d B:18-140)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2082002Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2082008Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 2082071Protein Chlorophenol reduction protein CprK [159314] (2 species)
  7. 2082075Species Desulfitobacterium hafniense [TaxId:49338] [159315] (6 PDB entries)
    Uniprot Q18R04 3-147! Uniprot Q18R04 9-147
  8. 2082090Domain d3e6db1: 3e6d B:18-140 [209406]
    Other proteins in same PDB: d3e6da2, d3e6db2
    automated match to d3e5ua2

Details for d3e6db1

PDB Entry: 3e6d (more details), 2 Å

PDB Description: crystal structure of cprk c200s
PDB Compounds: (B:) Cyclic nucleotide-binding protein

SCOPe Domain Sequences for d3e6db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e6db1 b.82.3.2 (B:18-140) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]}
ffpieklrnytqmglirdfakgsavimpgeeitsmiflvegkikldiifedgsekllyya
ggnsligklyptgnniyatameptrtcwfsekslrtvfrtdedmifeifknyltkvayya
rqv

SCOPe Domain Coordinates for d3e6db1:

Click to download the PDB-style file with coordinates for d3e6db1.
(The format of our PDB-style files is described here.)

Timeline for d3e6db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3e6db2