Lineage for d3dlxc2 (3dlx C:301-519)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922432Family c.124.1.3: CoA transferase beta subunit-like [74657] (4 proteins)
    catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest
  6. 2922451Protein Succinate:CoA transferase, C-terminal domain [82466] (2 species)
  7. 2922452Species Human (Homo sapiens) [TaxId:9606] [225514] (1 PDB entry)
  8. 2922455Domain d3dlxc2: 3dlx C:301-519 [209231]
    Other proteins in same PDB: d3dlxa1, d3dlxb1, d3dlxc1, d3dlxd1
    automated match to d1ooyb1
    complexed with gol

Details for d3dlxc2

PDB Entry: 3dlx (more details), 2.2 Å

PDB Description: crystal structure of human 3-oxoacid coa transferase 1
PDB Compounds: (C:) Succinyl-CoA:3-ketoacid-coenzyme A transferase 1

SCOPe Domain Sequences for d3dlxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dlxc2 c.124.1.3 (C:301-519) Succinate:CoA transferase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vreriikraalefedgmyanlgigipllasnfispnitvhlqsengvlglgpyprqhead
adlinagketvtilpgasffssdesfamirgghvdltmlgamqvskygdlanwmipgkmv
kgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdvdk
kkgltlielwegltvddvqkstgcdfavspklmpmqqia

SCOPe Domain Coordinates for d3dlxc2:

Click to download the PDB-style file with coordinates for d3dlxc2.
(The format of our PDB-style files is described here.)

Timeline for d3dlxc2: