Lineage for d3djck1 (3djc K:1-122)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1373353Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1373354Protein automated matches [226839] (35 species)
    not a true protein
  7. 1373551Species Legionella pneumophila [TaxId:272624] [225487] (1 PDB entry)
  8. 1373572Domain d3djck1: 3djc K:1-122 [209202]
    automated match to d3bexa1
    complexed with gol

Details for d3djck1

PDB Entry: 3djc (more details), 2.4 Å

PDB Description: crystal structure of pantothenate kinase from legionella pneumophila
PDB Compounds: (K:) Type III pantothenate kinase

SCOPe Domain Sequences for d3djck1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3djck1 c.55.1.0 (K:1-122) automated matches {Legionella pneumophila [TaxId: 272624]}
lilcidvgnshiyggvfdgdeiklrfrhtskvstsdelgiflksvlrenncspetirkia
icsvvpqvdyslrsacvkyfsidpfllqagvktglnikyrnpvevgadrianaiaathsf
pn

SCOPe Domain Coordinates for d3djck1:

Click to download the PDB-style file with coordinates for d3djck1.
(The format of our PDB-style files is described here.)

Timeline for d3djck1: