SCOPe 2.03: Structural Classification of Proteins

PDB entry 3djc

View 3djc on RCSB PDB site
Description: crystal structure of pantothenate kinase from legionella pneumophila
Class: transferase
Keywords: STRUCTURAL GENOMICS, PANTOTHENATE KINASE, PUTATIVE TRANSFERASE, PSI-2, PROTEIN STRUCTURE INITIATIVE, NEW YORK STRUCTURAL GENOMIX RESEARCH CONSORTIUM, NYSGXRC, ATP-binding, Coenzyme A biosynthesis, Kinase, Metal-binding, Nucleotide-binding, Transferase, New York SGX Research Center for Structural Genomics
Deposited on 2008-06-23, released 2008-07-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.261
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Type III pantothenate kinase
Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
Gene: coaX, lpg0911
Database cross-references and differences (RAF-indexed):
- Uniprot Q5ZX22 (3-End)
  - expression tag (2)
Domains in SCOPe 2.03: d3djca1, d3djca2
Chain 'B':
Compound: Type III pantothenate kinase
Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
Gene: coaX, lpg0911
Database cross-references and differences (RAF-indexed):
- Uniprot Q5ZX22 (3-End)
  - expression tag (1-2)
Domains in SCOPe 2.03: d3djcb1, d3djcb2
Chain 'C':
Compound: Type III pantothenate kinase
Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
Gene: coaX, lpg0911
Database cross-references and differences (RAF-indexed):
- Uniprot Q5ZX22 (3-257)
  - expression tag (2)
Domains in SCOPe 2.03: d3djcc1, d3djcc2
Chain 'D':
Compound: Type III pantothenate kinase
Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
Gene: coaX, lpg0911
Database cross-references and differences (RAF-indexed):
- Uniprot Q5ZX22 (3-257)
  - expression tag (1-2)
Domains in SCOPe 2.03: d3djcd1, d3djcd2
Chain 'E':
Compound: Type III pantothenate kinase
Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
Gene: coaX, lpg0911
Database cross-references and differences (RAF-indexed):
- Uniprot Q5ZX22 (3-257)
  - expression tag (2)
Domains in SCOPe 2.03: d3djce1, d3djce2
Chain 'F':
Compound: Type III pantothenate kinase
Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
Gene: coaX, lpg0911
Database cross-references and differences (RAF-indexed):
- Uniprot Q5ZX22 (3-257)
  - expression tag (2)
Domains in SCOPe 2.03: d3djcf1, d3djcf2
Chain 'G':
Compound: Type III pantothenate kinase
Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
Gene: coaX, lpg0911
Database cross-references and differences (RAF-indexed):
- Uniprot Q5ZX22 (3-End)
  - expression tag (1-2)
Domains in SCOPe 2.03: d3djcg1, d3djcg2
Chain 'H':
Compound: Type III pantothenate kinase
Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
Gene: coaX, lpg0911
Database cross-references and differences (RAF-indexed):
- Uniprot Q5ZX22 (3-End)
  - expression tag (2)
Domains in SCOPe 2.03: d3djch1, d3djch2
Chain 'I':
Compound: Type III pantothenate kinase
Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
Gene: coaX, lpg0911
Database cross-references and differences (RAF-indexed):
- Uniprot Q5ZX22 (3-End)
  - expression tag (2)
Domains in SCOPe 2.03: d3djci1, d3djci2
Chain 'J':
Compound: Type III pantothenate kinase
Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
Gene: coaX, lpg0911
Database cross-references and differences (RAF-indexed):
- Uniprot Q5ZX22 (3-End)
  - expression tag (2)
Domains in SCOPe 2.03: d3djcj1, d3djcj2
Chain 'K':
Compound: Type III pantothenate kinase
Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
Gene: coaX, lpg0911
Database cross-references and differences (RAF-indexed):
- Uniprot Q5ZX22 (3-End)
  - expression tag (2)
Domains in SCOPe 2.03: d3djck1, d3djck2
Chain 'L':
Compound: Type III pantothenate kinase
Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
Gene: coaX, lpg0911
Database cross-references and differences (RAF-indexed):
- Uniprot Q5ZX22 (3-End)
  - expression tag (2)
Domains in SCOPe 2.03: d3djcl1, d3djcl2
Heterogens: GOL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3djcA (A:)
mslilcidvgnshiyggvfdgdeiklrfrhtskvstsdelgiflksvlrenncspetirk
iaicsvvpqvdyslrsacvkyfsidpfllqagvktglnikyrnpvevgadrianaiaath
sfpnqniividfgtattfcaishkkaylggailpglrlsadalskntaklpsveiiktes
vvgrstiesiqsgvyygvlgackeliqrihheafngdqililatggfaslfdkqglydhl
vpdlvlqgirlaammntaeghhhhhh