Lineage for d3dj4a2 (3dj4 A:264-474)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1329958Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1329959Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 1330233Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 1330234Protein automated matches [190967] (25 species)
    not a true protein
  7. 1330319Species Mycobacterium tuberculosis [TaxId:1773] [224870] (6 PDB entries)
  8. 1330323Domain d3dj4a2: 3dj4 A:264-474 [209181]
    Other proteins in same PDB: d3dj4a1
    automated match to d1g95a1
    complexed with co, mg, ud1

Details for d3dj4a2

PDB Entry: 3dj4 (more details), 2.38 Å

PDB Description: crystal structure of glmu from mycobacterium tuberculosis in complex with uridine-diphosphate-n-acetylglucosamine.
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d3dj4a2:

Sequence, based on SEQRES records: (download)

>d3dj4a2 b.81.1.0 (A:264-474) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvgpdttltdvavgdgasvvr
thgssssigdgaavgpftylrpgtalgadgklgafvevknstigtgtkvphltyvgdadi
geysnigassvfvnydgtskrrttvgshvrtgsdtmfvapvtigdgaytgagtvvredvp
pgalavsagpqrnienwvqrkrpgspaaqas

Sequence, based on observed residues (ATOM records): (download)

>d3dj4a2 b.81.1.0 (A:264-474) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvgpdttltdvavgdgasvvr
thgssssigdgaavgpftylrpgtalgadgklgafvevknstigtgtkvphltyvgdadi
geysnigassvfvnrttvgshvrtgsdtmfvapvtigdgaytgagtvvredvppgalavs
agpqrnienwvqrkrpgspaaqas

SCOPe Domain Coordinates for d3dj4a2:

Click to download the PDB-style file with coordinates for d3dj4a2.
(The format of our PDB-style files is described here.)

Timeline for d3dj4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dj4a1