Lineage for d1g95a1 (1g95 A:252-452)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
superhelix turns are made of parallel beta-strands and (short) turnsSuperfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) 
superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins)
this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain
Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain [51172] (2 species) Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [63852] (5 PDB entries) 
Domain d1g95a1: 1g95 A:252-452 [60391]
Other proteins in same PDB: d1g95a2
Details for d1g95a1
PDB Entry: 1g95 (more details), 2.33 Å
PDB Description: crystal structure of s.pneumoniae glmu, apo form
PDB Compounds: (A:) n-acetylglucosamine-1-phosphate uridyltransferaseSCOPe Domain Sequences for d1g95a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g95a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
vsfvnpeatyididveiasevqieanvtlkgqtkigaetvltngtyvvdstigagavitn
smieessvadgvivgpyahirpnsslgaqvhignfvevkgssigentkaghltyigncev
gsnvnfgagtitvnydgknkyktvignnvfvgsnstiiapvelgdnslvgagstitkdvp
adaiaigrgrqinkdeyatrl
SCOPe Domain Coordinates for d1g95a1:
Click to download the PDB-style file with coordinates for d1g95a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g95a1:
- d1g95a1 first appeared in SCOP 1.57
- d1g95a1 appears in SCOPe 2.02
- d1g95a1 appears in SCOPe 2.04
- d1g95a1 appears in the current release, SCOPe 2.08
View in 3D
