Lineage for d3dfyj2 (3dfy J:125-343)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2445369Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2445853Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2445854Protein automated matches [226923] (78 species)
    not a true protein
  7. 2446427Species Thermotoga maritima [TaxId:243274] [225440] (5 PDB entries)
  8. 2446449Domain d3dfyj2: 3dfy J:125-343 [209145]
    Other proteins in same PDB: d3dfya1, d3dfyb1, d3dfyc1, d3dfyd1, d3dfye1, d3dfyf1, d3dfyg1, d3dfyh1, d3dfyi1, d3dfyj1, d3dfyk1, d3dfyl1, d3dfym1, d3dfyn1, d3dfyo1, d3dfyp1
    automated match to d1jpma1
    complexed with mg

Details for d3dfyj2

PDB Entry: 3dfy (more details), 2.1 Å

PDB Description: Crystal structure of apo dipeptide epimerase from Thermotoga maritima
PDB Compounds: (J:) Muconate cycloisomerase

SCOPe Domain Sequences for d3dfyj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dfyj2 c.1.11.0 (J:125-343) automated matches {Thermotoga maritima [TaxId: 243274]}
krdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgak
yivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesa
rtkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsv
hfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvk

SCOPe Domain Coordinates for d3dfyj2:

Click to download the PDB-style file with coordinates for d3dfyj2.
(The format of our PDB-style files is described here.)

Timeline for d3dfyj2: