Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (78 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [225440] (5 PDB entries) |
Domain d3dfyf2: 3dfy F:125-343 [209137] Other proteins in same PDB: d3dfya1, d3dfyb1, d3dfyc1, d3dfyd1, d3dfye1, d3dfyf1, d3dfyg1, d3dfyh1, d3dfyi1, d3dfyj1, d3dfyk1, d3dfyl1, d3dfym1, d3dfyn1, d3dfyo1, d3dfyp1 automated match to d1jpma1 complexed with mg |
PDB Entry: 3dfy (more details), 2.1 Å
SCOPe Domain Sequences for d3dfyf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dfyf2 c.1.11.0 (F:125-343) automated matches {Thermotoga maritima [TaxId: 243274]} krdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgak yivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesa rtkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsv hfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvk
Timeline for d3dfyf2:
View in 3D Domains from other chains: (mouse over for more information) d3dfya1, d3dfya2, d3dfyb1, d3dfyb2, d3dfyc1, d3dfyc2, d3dfyd1, d3dfyd2, d3dfye1, d3dfye2, d3dfyg1, d3dfyg2, d3dfyh1, d3dfyh2, d3dfyi1, d3dfyi2, d3dfyj1, d3dfyj2, d3dfyk1, d3dfyk2, d3dfyl1, d3dfyl2, d3dfym1, d3dfym2, d3dfyn1, d3dfyn2, d3dfyo1, d3dfyo2, d3dfyp1, d3dfyp2 |