SCOPe 2.07: Domain d3dfyf2: 3dfy F:125-343

Lineage for d3dfyf2 (3dfy F:125-343)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (78 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [225440] (5 PDB entries)

8. Domain d3dfyf2: 3dfy F:125-343 [209137]
   Other proteins in same PDB: d3dfya1, d3dfyb1, d3dfyc1, d3dfyd1, d3dfye1, d3dfyf1, d3dfyg1, d3dfyh1, d3dfyi1, d3dfyj1, d3dfyk1, d3dfyl1, d3dfym1, d3dfyn1, d3dfyo1, d3dfyp1
   automated match to d1jpma1
   complexed with mg

Details for d3dfyf2

PDB Entry: 3dfy, 2.1 Å

PDB Description: Crystal structure of apo dipeptide epimerase from Thermotoga maritima

PDB Compounds: (F:) Muconate cycloisomerase

SCOPe Domain Sequences for d3dfyf2:

Sequence; same for both SEQRES and ATOM records:

>d3dfyf2 c.1.11.0 (F:125-343) automated matches {Thermotoga maritima [TaxId: 243274]}
krdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgak
yivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesa
rtkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsv
hfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvk

Timeline for d3dfyf2:

• d3dfyf2 first appeared in SCOPe 2.03
  
• d3dfyf2 appears in SCOPe 2.06
  
• d3dfyf2 appears in the current release, SCOPe 2.08