Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (95 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [225439] (5 PDB entries) |
Domain d3desc1: 3des C:3-124 [209117] Other proteins in same PDB: d3desa2, d3desb2, d3desc2, d3desd2 automated match to d1jpma2 complexed with ala, mg |
PDB Entry: 3des (more details), 2.3 Å
SCOPe Domain Sequences for d3desc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3desc1 d.54.1.0 (C:3-124) automated matches {Thermotoga maritima [TaxId: 243274]} rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll gg
Timeline for d3desc1: