Lineage for d3ceib2 (3cei B:85-210)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552893Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2552894Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2553188Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2553189Protein automated matches [226860] (37 species)
    not a true protein
  7. 2553277Species Helicobacter pylori [TaxId:210] [225465] (1 PDB entry)
  8. 2553279Domain d3ceib2: 3cei B:85-210 [208859]
    Other proteins in same PDB: d3ceia1, d3ceib1
    automated match to d1bsma2
    complexed with fe, so4

Details for d3ceib2

PDB Entry: 3cei (more details), 2.4 Å

PDB Description: Crystal Structure of Superoxide Dismutase from Helicobacter pylori
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d3ceib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ceib2 d.44.1.0 (B:85-210) automated matches {Helicobacter pylori [TaxId: 210]}
talsdelkgalekdfgslekfkedfiksattlfgsgwnwaaynldtqkieiiqtsnaqtp
vtdkkvpllvvdvwehayyidhknarpvylekfyghinwhfvsqcyewakkeglgsvdyy
inelvh

SCOPe Domain Coordinates for d3ceib2:

Click to download the PDB-style file with coordinates for d3ceib2.
(The format of our PDB-style files is described here.)

Timeline for d3ceib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ceib1