Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (37 species) not a true protein |
Species Helicobacter pylori [TaxId:210] [225465] (1 PDB entry) |
Domain d3ceia2: 3cei A:85-213 [208857] Other proteins in same PDB: d3ceia1, d3ceib1 automated match to d1bsma2 complexed with fe, so4 |
PDB Entry: 3cei (more details), 2.4 Å
SCOPe Domain Sequences for d3ceia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ceia2 d.44.1.0 (A:85-213) automated matches {Helicobacter pylori [TaxId: 210]} talsdelkgalekdfgslekfkedfiksattlfgsgwnwaaynldtqkieiiqtsnaqtp vtdkkvpllvvdvwehayyidhknarpvylekfyghinwhfvsqcyewakkeglgsvdyy inelvhkkl
Timeline for d3ceia2: