SCOPe 2.06: Domain d3ceib1: 3cei B:1-84

Lineage for d3ceib1 (3cei B:1-84)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (32 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [225464] (1 PDB entry)

8. Domain d3ceib1: 3cei B:1-84 [208858]
   Other proteins in same PDB: d3ceia2, d3ceib2
   automated match to d1bsma1
   complexed with fe, so4

Details for d3ceib1

PDB Entry: 3cei, 2.4 Å

PDB Description: Crystal Structure of Superoxide Dismutase from Helicobacter pylori

PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d3ceib1:

Sequence; same for both SEQRES and ATOM records:

>d3ceib1 a.2.11.0 (B:1-84) automated matches {Helicobacter pylori [TaxId: 210]}
mftlrelpfakdsmgdflspvafdfhhgkhhqtyvnnlnnlikgtdfeksslfailtkss
ggvfnnaaqiynhdfywdclspka

Timeline for d3ceib1:

• d3ceib1 first appeared in SCOPe 2.03
  
• d3ceib1 appears in SCOPe 2.05
  
• d3ceib1 appears in SCOPe 2.07
  
• d3ceib1 appears in the current release, SCOPe 2.08