Lineage for d3aova_ (3aov A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897868Species Pyrococcus horikoshii OT3 [TaxId:70601] [225184] (6 PDB entries)
  8. 2897873Domain d3aova_: 3aov A: [208289]
    automated match to d4gebb_
    complexed with plp

Details for d3aova_

PDB Entry: 3aov (more details), 1.72 Å

PDB Description: Crystal structure of Pyrococcus horikoshii kynurenine aminotransferase in complex with PLP
PDB Compounds: (A:) Putative uncharacterized protein PH0207

SCOPe Domain Sequences for d3aova_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aova_ c.67.1.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
smlgdverffskkalemrasevrellklvetsdiislagglpnpktfpkeiirdilveim
ekyadkalqygttkgftplretlmkwlgkrygisqdndimitsgsqqaldligrvflnpg
divvveaptylaalqafnfyepqyiqiplddegmkveileeklkelksqgkkvkvvytvp
tfqnpagvtmnedrrkyllelaseydfivveddpygelrysgnpekkikaldnegrviyl
gtfskilapgfrigwmvgdpgiirkmeiakqstdlctnvfgqvvawryvdggylekhipe
irkfykprrdamlealeefmpegvkwtkpeggmfiwvtlpdgidskkmleraikkgvayv
pgeafyahrdvkntmrlnftyvdedkimegikrlaetikeelka

SCOPe Domain Coordinates for d3aova_:

Click to download the PDB-style file with coordinates for d3aova_.
(The format of our PDB-style files is described here.)

Timeline for d3aova_: