Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (166 species) not a true protein |
Species Pyrococcus horikoshii OT3 [TaxId:70601] [225184] (6 PDB entries) |
Domain d3aova_: 3aov A: [208289] automated match to d4gebb_ complexed with plp |
PDB Entry: 3aov (more details), 1.72 Å
SCOPe Domain Sequences for d3aova_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aova_ c.67.1.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} smlgdverffskkalemrasevrellklvetsdiislagglpnpktfpkeiirdilveim ekyadkalqygttkgftplretlmkwlgkrygisqdndimitsgsqqaldligrvflnpg divvveaptylaalqafnfyepqyiqiplddegmkveileeklkelksqgkkvkvvytvp tfqnpagvtmnedrrkyllelaseydfivveddpygelrysgnpekkikaldnegrviyl gtfskilapgfrigwmvgdpgiirkmeiakqstdlctnvfgqvvawryvdggylekhipe irkfykprrdamlealeefmpegvkwtkpeggmfiwvtlpdgidskkmleraikkgvayv pgeafyahrdvkntmrlnftyvdedkimegikrlaetikeelka
Timeline for d3aova_: