Lineage for d3amga_ (3amg A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2833233Species Thermotoga maritima [TaxId:243274] [226181] (7 PDB entries)
  8. 2833250Domain d3amga_: 3amg A: [208264]
    automated match to d1ceoa_
    complexed with bgc; mutant

Details for d3amga_

PDB Entry: 3amg (more details), 2.4 Å

PDB Description: crystal structures of thermotoga maritima cel5a in complex with cellobiose substrate, mutant form
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d3amga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3amga_ c.1.8.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
gvdpfernkilgrginignaleapnegdwgvvikdeffdiikeagfshvripirwsthay
afppykimdrffkrvdevingalkrglavvinihhyeelmndpeehkerflalwkqiadr
ykdypetlffeilnaphgnltpekwnelleealkvirsidkkhtiiigtaewggisalek
lsvpkweknsivtihyynpfefthqgaewvegsekwlgrkwgspddqkhlieefnfieew
skknkrpiyigefgayrkadlesrikwtsfvvremekrrwswaywefcsgfgvydtlrkt
wnkdllealig

SCOPe Domain Coordinates for d3amga_:

Click to download the PDB-style file with coordinates for d3amga_.
(The format of our PDB-style files is described here.)

Timeline for d3amga_: