Class b: All beta proteins [48724] (177 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (37 species) not a true protein |
Species Clostridium josui [TaxId:1499] [225844] (4 PDB entries) |
Domain d3acha_: 3ach A: [208198] automated match to d1uwwa_ complexed with ca, po4 |
PDB Entry: 3ach (more details), 1.4 Å
SCOPe Domain Sequences for d3acha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3acha_ b.18.1.0 (A:) automated matches {Clostridium josui [TaxId: 1499]} ravveapvehapigkatlpstfedstrqgwawdatsgvqsaltikdaneskaiswevkyp evkpvdgwasaprimlgnvnttrgnnkyltfdfylkptqaskgsltislafappslgfwa qatgdvniplsslskmkkttdglyhfqvkydldkindgkvltantvlrditivvadgnsd fagtmyldnirfe
Timeline for d3acha_: