SCOPe 2.06: Domain d3a2fa1: 3a2f A:1-347

Lineage for d3a2fa1 (3a2f A:1-347)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (35 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [224898] (3 PDB entries)

8. Domain d3a2fa1: 3a2f A:1-347 [208096]
   Other proteins in same PDB: d3a2fa2, d3a2fb1, d3a2fb2
   automated match to d2vwja1
   protein/DNA complex; mutant

Details for d3a2fa1

PDB Entry: 3a2f, 2.67 Å

PDB Description: crystal structure of pyrococcus furiosus dna polymerase/pcna monomer mutant complex

PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d3a2fa1:

Sequence; same for both SEQRES and ATOM records:

>d3a2fa1 c.55.3.0 (A:1-347) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mildvdyiteegkpvirlfkkengkfkiehdrtfrpyiyallrddskieevkkitgerhg
kivrivdvekvekkflgkpitvwklylehpqdvptirekvrehpavvdifeydipfakry
lidkglipmegeeelkilafdietlyhegeefgkgpiimisyadeneakvitwknidlpy
vevvsseremikrflriirekdpdiivtyngdsfdfpylakraeklgikltigrdgsepk
mqrigdmtavevkgrihfdlyhvitrtinlptytleavyeaifgkpkekvyadeiakawe
sgenlervakysmedakatyelgkeflpmeiqlsrlvgqplwdvsrs

Timeline for d3a2fa1:

• d3a2fa1 first appeared in SCOPe 2.03
  
• d3a2fa1 appears in SCOPe 2.05
  
• d3a2fa1 appears in SCOPe 2.07
  
• d3a2fa1 appears in the current release, SCOPe 2.08