Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (78 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [225416] (1 PDB entry) |
Domain d2zc8b2: 2zc8 B:126-368 [207813] Other proteins in same PDB: d2zc8a1, d2zc8b1 automated match to d1wuea1 |
PDB Entry: 2zc8 (more details), 1.95 Å
SCOPe Domain Sequences for d2zc8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zc8b2 c.1.11.0 (B:126-368) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} vrqavevgvslgiqpsvedtlrvverhleegyrriklkikpgwdyevlkavreafpeatl tadansayslanlaqlkrldelrldyieqplayddlldhaklqrelstpicldesltgae karkaielgagrvfnvkparlgghgeslrvhalaesagiplwmggmleagvgrahnlhla tlpgftkpgdvssasryweediveealeakdglmpvpegvgigvhlklpfvervtlwqry msa
Timeline for d2zc8b2: