SCOPe 2.08: Domain d2zc8b2: 2zc8 B:126-368

Lineage for d2zc8b2 (2zc8 B:126-368)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225416] (1 PDB entry)

8. Domain d2zc8b2: 2zc8 B:126-368 [207813]
   Other proteins in same PDB: d2zc8a1, d2zc8b1
   automated match to d1wuea1

Details for d2zc8b2

PDB Entry: 2zc8, 1.95 Å

PDB Description: Crystal structure of N-Acylamino Acid Racemase from Thermus thermophilus HB8

PDB Compounds: (B:) N-acylamino acid racemase

SCOPe Domain Sequences for d2zc8b2:

Sequence; same for both SEQRES and ATOM records:

>d2zc8b2 c.1.11.0 (B:126-368) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
vrqavevgvslgiqpsvedtlrvverhleegyrriklkikpgwdyevlkavreafpeatl
tadansayslanlaqlkrldelrldyieqplayddlldhaklqrelstpicldesltgae
karkaielgagrvfnvkparlgghgeslrvhalaesagiplwmggmleagvgrahnlhla
tlpgftkpgdvssasryweediveealeakdglmpvpegvgigvhlklpfvervtlwqry
msa

Timeline for d2zc8b2:

• d2zc8b2 first appeared in SCOPe 2.03
  
• d2zc8b2 appears in SCOPe 2.07