Class a: All alpha proteins [46456] (290 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
Protein Transcriptional regulator Cgl2612 [140895] (1 species) |
Species Corynebacterium glutamicum [TaxId:1718] [140896] (5 PDB entries) Uniprot Q8NMG3 75-175 |
Domain d2yveb2: 2yve B:75-174 [207726] Other proteins in same PDB: d2yvea1, d2yveb1 automated match to d2zoya2 complexed with cl, gol, mbt |
PDB Entry: 2yve (more details), 1.4 Å
SCOPe Domain Sequences for d2yveb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yveb2 a.121.1.1 (B:75-174) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]} edplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqwipdtddlendahkr avylvqlaadglfvhdyihddvlskskrqamletilelip
Timeline for d2yveb2: