![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species) |
![]() | Species Human (Homo sapiens), HLA-CW3 [TaxId:9606] [48955] (1 PDB entry) |
![]() | Domain d1efxa1: 1efx A:182-278 [20767] Other proteins in same PDB: d1efxa2, d1efxd1, d1efxd2, d1efxe1, d1efxe2 |
PDB Entry: 1efx (more details), 3 Å
SCOP Domain Sequences for d1efxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efxa1 b.1.1.2 (A:182-278) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-CW3} aehpkthvthhpvsdheatlrcwalgfypaeitltwqwdgedqtqdtelvetrpagdgtf qkwaavvvpsgeeqrytchvqheglpepltlrwepss
Timeline for d1efxa1: