Lineage for d1efxa2 (1efx A:1-181)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) 
Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins) Protein MHC class I, alpha-1 and alpha-2 domains [54468] (18 species) 
Species Human (Homo sapiens), HLA-CW3 [TaxId:9606] [54477] (1 PDB entry) 
Domain d1efxa2: 1efx A:1-181 [38273]
Other proteins in same PDB: d1efxa1, d1efxb1, d1efxd1, d1efxd2, d1efxe1, d1efxe2
Details for d1efxa2
PDB Entry: 1efx (more details), 3 Å
PDB Description: structure of a complex between the human natural killer cell receptor kir2dl2 and a class i mhc ligand hla-cw3
SCOP Domain Sequences for d1efxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efxa2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-CW3}
gshsmryfytavsrpgrgephfiavgyvddtqfvrfdsdaasprgeprapwveqegpeyw
dretqkykrqaqtdrvslrnlrgyynqseagshiiqrmygcdvgpdgrllrgydqyaydg
kdyialnedlrswtaadtaaqitqrkweaareaeqlrayleglcvewlrrylkngketlq
r
SCOP Domain Coordinates for d1efxa2:
Click to download the PDB-style file with coordinates for d1efxa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1efxa2:
View in 3D
