Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) |
Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
Protein automated matches [190066] (7 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [193543] (2 PDB entries) |
Domain d2ybvf_: 2ybv F: [207529] Other proteins in same PDB: d2ybva1, d2ybva2, d2ybvc1, d2ybvc2, d2ybve1, d2ybve2, d2ybvg1, d2ybvg2, d2ybvi1, d2ybvi2, d2ybvk1, d2ybvk2, d2ybvm1, d2ybvm2, d2ybvo1, d2ybvo2 automated match to d3zxwd_ complexed with cl |
PDB Entry: 2ybv (more details), 2.3 Å
SCOPe Domain Sequences for d2ybvf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ybvf_ d.73.1.1 (F:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} tlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklplfn ctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykp
Timeline for d2ybvf_: