SCOPe 2.07: Domain d2ybvb_: 2ybv B:

Lineage for d2ybvb_ (2ybv B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)

6. Protein automated matches [190066] (7 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [193543] (2 PDB entries)

8. Domain d2ybvb_: 2ybv B: [207523]
   Other proteins in same PDB: d2ybva1, d2ybva2, d2ybvc1, d2ybvc2, d2ybve1, d2ybve2, d2ybvg1, d2ybvg2, d2ybvi1, d2ybvi2, d2ybvk1, d2ybvk2, d2ybvm1, d2ybvm2, d2ybvo1, d2ybvo2
   automated match to d3zxwd_
   complexed with cl

Details for d2ybvb_

PDB Entry: 2ybv, 2.3 Å

PDB Description: structure of rubisco from thermosynechococcus elongatus

PDB Compounds: (B:) ribulose bisphosphate carboxylase small subunit

SCOPe Domain Sequences for d2ybvb_:

Sequence; same for both SEQRES and ATOM records:

>d2ybvb_ d.73.1.1 (B:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
tlpkerryetfsylpplsdaqiarqiqyaidqgyhpcvefnetsnaeirywtmwklplfn
ctnaqdvlnevqqcrseypncfirvvafdnikqcqvmsfivykp

Timeline for d2ybvb_:

• d2ybvb_ first appeared in SCOPe 2.03
  
• d2ybvb_ appears in SCOPe 2.06
  
• d2ybvb_ appears in the current release, SCOPe 2.08