SCOPe 2.06: Domain d2xpwa2: 2xpw A:68-208

Lineage for d2xpwa2 (2xpw A:68-208)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Tetracyclin repressor (Tet-repressor, TetR) [48500] (1 species)

7. Species Escherichia coli [TaxId:562] [48501] (28 PDB entries)

8. Domain d2xpwa2: 2xpw A:68-208 [207318]
   Other proteins in same PDB: d2xpwa1, d2xpwa3
   automated match to d1bjza2
   complexed with cl, mes, mg, otc

Details for d2xpwa2

PDB Entry: 2xpw, 1.44 Å

PDB Description: tetr(d) in complex with oxytetracycline and magnesium.

PDB Compounds: (A:) tetracycline repressor protein class d

SCOPe Domain Sequences for d2xpwa2:

Sequence; same for both SEQRES and ATOM records:

>d2xpwa2 a.121.1.1 (A:68-208) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltallqiv

Timeline for d2xpwa2:

• d2xpwa2 first appeared in SCOPe 2.03
  
• d2xpwa2 appears in SCOPe 2.05
  
• d2xpwa2 appears in SCOPe 2.07
  
• d2xpwa2 appears in the current release, SCOPe 2.08