Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225955] (5 PDB entries) |
Domain d2xgza1: 2xgz A:1-140 [207219] Other proteins in same PDB: d2xgza2, d2xgza3, d2xgzb2, d2xgzb3 automated match to d1pdza2 complexed with mg, pep; mutant |
PDB Entry: 2xgz (more details), 1.8 Å
SCOPe Domain Sequences for d2xgza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xgza1 d.54.1.0 (A:1-140) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} avskvyarsvydsrgnptvevelttekgvfrsivpsgantgvhealemrdgdkskwmgkg vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra aaaeknvplykhladlsksk
Timeline for d2xgza1: