Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein Exochitosanase CsxA, domains 2, 4 and 5 [158903] (1 species) |
Species Amycolatopsis orientalis [TaxId:31958] [158904] (3 PDB entries) Uniprot Q56F26 226-335! Uniprot Q56F26 675-777! Uniprot Q56F26 778-899 |
Domain d2x09b4: 2x09 B:675-777 [207082] Other proteins in same PDB: d2x09a1, d2x09a3, d2x09b1, d2x09b3 automated match to d2vzsa3 complexed with cd, x09 |
PDB Entry: 2x09 (more details), 2.4 Å
SCOPe Domain Sequences for d2x09b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x09b4 b.1.4.1 (B:675-777) Exochitosanase CsxA, domains 2, 4 and 5 {Amycolatopsis orientalis [TaxId: 31958]} plhiqyshdnrsvvvinqtsnavsgltattklynldgtekysntktglsvgalgakatav tvpavsglsttylaknvltdssgkevsrnvywlstkadtlnwg
Timeline for d2x09b4: