Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
Protein Exochitosanase CsxA [158961] (1 species) |
Species Amycolatopsis orientalis [TaxId:31958] [158962] (3 PDB entries) Uniprot Q56F26 42-225 |
Domain d2x05b1: 2x05 B:48-225 [207069] Other proteins in same PDB: d2x05a2, d2x05a3, d2x05a4, d2x05a5, d2x05b2, d2x05b3, d2x05b4, d2x05b5 automated match to d2vzsa4 complexed with cd, x05 |
PDB Entry: 2x05 (more details), 2.3 Å
SCOPe Domain Sequences for d2x05b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x05b1 b.18.1.5 (B:48-225) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} agnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfyst nmqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngayt rhdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsg
Timeline for d2x05b1: