Lineage for d2wqxb2 (2wqx B:241-321)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299386Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1300237Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1300238Protein automated matches [190226] (22 species)
    not a true protein
  7. 1300299Species Listeria monocytogenes [TaxId:169963] [225327] (7 PDB entries)
  8. 1300303Domain d2wqxb2: 2wqx B:241-321 [206967]
    Other proteins in same PDB: d2wqxa1, d2wqxb1
    automated match to d1m9sa1
    mutant

Details for d2wqxb2

PDB Entry: 2wqx (more details), 2.03 Å

PDB Description: inlb321_4r: s199r, d200r, g206r, a227r, c242a mutant of the listeria monocytogenes inlb internalin domain
PDB Compounds: (B:) internalin b

SCOPe Domain Sequences for d2wqxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wqxb2 b.1.18.0 (B:241-321) automated matches {Listeria monocytogenes [TaxId: 169963]}
ealnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyq
pvtigkakarfhgrvtqplke

SCOPe Domain Coordinates for d2wqxb2:

Click to download the PDB-style file with coordinates for d2wqxb2.
(The format of our PDB-style files is described here.)

Timeline for d2wqxb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wqxb1