Lineage for d2wofb2 (2wof B:91-185)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543045Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) (S)
  5. 2543046Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 2543047Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 2543177Species Escherichia coli [TaxId:562] [54419] (16 PDB entries)
  8. 2543196Domain d2wofb2: 2wof B:91-185 [206928]
    Other proteins in same PDB: d2wofa1, d2wofa4, d2wofb1, d2wofb4
    automated match to d1oacb2
    complexed with cu, na

Details for d2wofb2

PDB Entry: 2wof (more details), 2.25 Å

PDB Description: edta treated e. coli copper amine oxidase
PDB Compounds: (B:) primary amine oxidase

SCOPe Domain Sequences for d2wofb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wofb2 d.17.2.1 (B:91-185) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]}
krphplnaltadeikqaveivkasadfkpntrfteisllppdkeavwafalenkpvdqpr
kadvimldgkhiieavvdlqnnkllswqpikdahg

SCOPe Domain Coordinates for d2wofb2:

Click to download the PDB-style file with coordinates for d2wofb2.
(The format of our PDB-style files is described here.)

Timeline for d2wofb2: