Lineage for d2wofb1 (2wof B:6-90)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2568896Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 2568897Superfamily d.82.1: Copper amine oxidase, domain N [55383] (2 families) (S)
    automatically mapped to Pfam PF07833
  5. 2568898Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)
  6. 2568899Protein Copper amine oxidase, domain N [55385] (1 species)
    non-conserved N-terminal domain
  7. 2568900Species Escherichia coli [TaxId:562] [55386] (16 PDB entries)
  8. 2568910Domain d2wofb1: 2wof B:6-90 [206927]
    Other proteins in same PDB: d2wofa2, d2wofa3, d2wofa4, d2wofb2, d2wofb3, d2wofb4
    automated match to d1oacb4
    complexed with cu, na

Details for d2wofb1

PDB Entry: 2wof (more details), 2.25 Å

PDB Description: edta treated e. coli copper amine oxidase
PDB Compounds: (B:) primary amine oxidase

SCOPe Domain Sequences for d2wofb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wofb1 d.82.1.1 (B:6-90) Copper amine oxidase, domain N {Escherichia coli [TaxId: 562]}
hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd
nkawvsdtfindvfqsgldqtfqve

SCOPe Domain Coordinates for d2wofb1:

Click to download the PDB-style file with coordinates for d2wofb1.
(The format of our PDB-style files is described here.)

Timeline for d2wofb1: