SCOPe 2.08: Domain d2wljb1: 2wlj B:23-138

Lineage for d2wljb1 (2wlj B:23-138)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families)
   Pfam PF00520

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Inward rectifier potassium channel kirbac3.1 [118227] (1 species)

7. Species Magnetospirillum magnetotacticum [TaxId:188] [118228] (4 PDB entries)
   Uniprot Q8YY97 # 46% sequence identity; Anabaena sp. PCC 7120 TaxID: 103690

8. Domain d2wljb1: 2wlj B:23-138 [206884]
   Other proteins in same PDB: d2wlja2, d2wlja3, d2wljb2, d2wljb3
   automated match to d1xl4a2
   complexed with ca, cl, k, spm

Details for d2wljb1

PDB Entry: 2wlj, 2.6 Å

PDB Description: potassium channel from magnetospirillum magnetotacticum

PDB Compounds: (B:) potassium channel

SCOPe Domain Sequences for d2wljb1:

Sequence, based on SEQRES records:

>d2wljb1 f.14.1.1 (B:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]}
itrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylacgdvienarpgs
ftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasliyarftrp

Sequence, based on observed residues (ATOM records):

>d2wljb1 f.14.1.1 (B:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]}
itrlddhyhdlltvswpvfitlitglylvtnalfalaylacgdvienarpgsftdafffs
vqtmatigygklipigplantlvtlealcgmlglavaasliyarftrp

Timeline for d2wljb1:

• d2wljb1 first appeared in SCOPe 2.03
  
• d2wljb1 appears in SCOPe 2.07