SCOP 1.63: Domain d1dqtd_: 1dqt D:

Lineage for d1dqtd_ (1dqt D:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoreceptor CTLA-4 (CD152), N-terminal fragment [48939] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48941] (1 PDB entry)

8. Domain d1dqtd_: 1dqt D: [20656]
   complexed with cl, edo

Details for d1dqtd_

PDB Entry: 1dqt, 2 Å

PDB Description: the crystal structure of murine ctla4 (cd152)

SCOP Domain Sequences for d1dqtd_:

Sequence; same for both SEQRES and ATOM records:

>d1dqtd_ b.1.1.1 (D:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus)}
iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf
ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvidp

Timeline for d1dqtd_:

• d1dqtd_ first appeared (with stable ids) in SCOP 1.55
  
• d1dqtd_ appears in SCOP 1.61
  
• d1dqtd_ appears in SCOP 1.65
  
• d1dqtd_ appears in the current release, SCOPe 2.08