Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoreceptor CTLA-4 (CD152), N-terminal fragment [48939] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [48941] (1 PDB entry) |
Domain d1dqtc_: 1dqt C: [20655] |
PDB Entry: 1dqt (more details), 2 Å
SCOP Domain Sequences for d1dqtc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dqtc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus)} iqvtqpsvvlasshgvasfpceyspshntdevrvtvlrqtndqmtevcattftekntvgf ldypfcsgtfnesrvnltiqglravdtglylckvelmypppyfvgmgngtqiyvidp
Timeline for d1dqtc_: