Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) |
Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
Species Escherichia coli [TaxId:562] [54419] (16 PDB entries) |
Domain d2w0qb3: 2w0q B:186-300 [206559] Other proteins in same PDB: d2w0qa1, d2w0qa4, d2w0qb1, d2w0qb4 automated match to d1oacb3 complexed with ca, cu, xe |
PDB Entry: 2w0q (more details), 2.48 Å
SCOPe Domain Sequences for d2w0qb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w0qb3 d.17.2.1 (B:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]} mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
Timeline for d2w0qb3:
View in 3D Domains from other chains: (mouse over for more information) d2w0qa1, d2w0qa2, d2w0qa3, d2w0qa4 |