Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.0: automated matches [227136] (1 protein) not a true family |
Protein automated matches [226838] (4 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [225338] (3 PDB entries) |
Domain d2vxya1: 2vxy A:11-208 [206532] Other proteins in same PDB: d2vxya2 automated match to d1rq2a1 complexed with cit, k |
PDB Entry: 2vxy (more details), 1.7 Å
SCOPe Domain Sequences for d2vxya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vxya1 c.32.1.0 (A:11-208) automated matches {Bacillus subtilis [TaxId: 1423]} lasikvigvggggnnavnrmienevqgveyiavntdaqalnlskaevkmqigakltrglg aganpevgkkaaeeskeqieealkgadmvfvtagmgggtgtgaapviaqiakdlgaltvg vvtrpftfegrkrqlqaaggisamkeavdtlivipndrileivdkntpmleafreadnvl rqgvqgisdliatpglin
Timeline for d2vxya1: