Lineage for d1rq2a1 (1rq2 A:8-205)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) 
automatically mapped to Pfam PF00091Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) Protein Cell-division protein FtsZ [52492] (9 species) 
Species Mycobacterium tuberculosis [TaxId:1773] [110501] (6 PDB entries)
Uniprot O08378
Domain d1rq2a1: 1rq2 A:8-205 [105048]
Other proteins in same PDB: d1rq2a2, d1rq2b2
complexed with cit
Details for d1rq2a1
PDB Entry: 1rq2 (more details), 1.86 Å
PDB Description: mycobacterium tuberculosis ftsz in complex with citrate
PDB Compounds: (A:) cell division protein ftszSCOPe Domain Sequences for d1rq2a1:
Sequence, based on SEQRES records: (download)
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstrglg
agadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvg
vvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevl
lngvqgitdlittpglin
Sequence, based on observed residues (ATOM records): (download)
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstgadp
evgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvgvvtrp
fsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevllngvq
gitdlittpglin
SCOPe Domain Coordinates for d1rq2a1:
Click to download the PDB-style file with coordinates for d1rq2a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rq2a1:
- d1rq2a1 first appeared in SCOP 1.69
- d1rq2a1 appears in SCOPe 2.06
- d1rq2a1 appears in the current release, SCOPe 2.08
View in 3D
