SCOP 1.61: Domain d1g6rc1: 1g6r C:1-117

Lineage for d1g6rc1 (1g6r C:1-117)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)

7. Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (14 PDB entries)

8. Domain d1g6rc1: 1g6r C:1-117 [20617]
   Other proteins in same PDB: d1g6ra2, d1g6rb2, d1g6rc2, d1g6rd2, d1g6rh1, d1g6rh2, d1g6ri1, d1g6ri2, d1g6rl1, d1g6rm1

Details for d1g6rc1

PDB Entry: 1g6r, 2.8 Å

PDB Description: a functional hot spot for antigen recognition in a superagonist tcr/mhc complex

SCOP Domain Sequences for d1g6rc1:

Sequence; same for both SEQRES and ATOM records:

>d1g6rc1 b.1.1.1 (C:1-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpy

Timeline for d1g6rc1:

• d1g6rc1 first appeared (with stable ids) in SCOP 1.55
  
• d1g6rc1 appears in SCOP 1.59
  
• d1g6rc1 appears in SCOP 1.63
  
• d1g6rc1 appears in the current release, SCOPe 2.08