Lineage for d1g6rc2 (1g6r C:118-213)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 160265Protein T-cell antigen receptor [49125] (6 species)
  7. 160293Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (5 PDB entries)
  8. 160302Domain d1g6rc2: 1g6r C:118-213 [21555]
    Other proteins in same PDB: d1g6ra1, d1g6rb1, d1g6rc1, d1g6rd1, d1g6rh1, d1g6rh2, d1g6ri1, d1g6ri2, d1g6rl1, d1g6rm1

Details for d1g6rc2

PDB Entry: 1g6r (more details), 2.8 Å

PDB Description: a functional hot spot for antigen recognition in a superagonist tcr/mhc complex
PDB Compounds: (C:)

SCOP Domain Sequences for d1g6rc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6rc2 b.1.1.2 (C:118-213) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
iqnpepavyalkdprsqdstlclftdfdsqinvpktmesgtfitdatvldmkamdsksng
aiawsnqtsftcqdifketnatypssdvpc

SCOP Domain Coordinates for d1g6rc2:

Click to download the PDB-style file with coordinates for d1g6rc2.
(The format of our PDB-style files is described here.)

Timeline for d1g6rc2: