SCOPe 2.07: Domain d2rc6a2: 2rc6 A:159-314

Lineage for d2rc6a2 (2rc6 A:159-314)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (19 species)
   not a true protein

7. Species Leptospira interrogans [TaxId:173] [225434] (2 PDB entries)

8. Domain d2rc6a2: 2rc6 A:159-314 [206051]
   Other proteins in same PDB: d2rc6a1, d2rc6b1, d2rc6c1, d2rc6d1
   automated match to d1qufa2
   complexed with fad, nap, so4, zn

Details for d2rc6a2

PDB Entry: 2rc6, 2.7 Å

PDB Description: Refined structure of FNR from Leptospira interrogans bound to NADP+

PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d2rc6a2:

Sequence; same for both SEQRES and ATOM records:

>d2rc6a2 c.25.1.0 (A:159-314) automated matches {Leptospira interrogans [TaxId: 173]}
lpntdfsgdimflatgtgiapfigmseellehklikftgnitlvygapysdelvmmdylk
gleskhknfklitaisreeknsfdggrmyishrvreqaeavkkilngggrfyicggpkgm
ekgvieeiqkisgntgtyeefkhhlegahqlfvety

Timeline for d2rc6a2:

• d2rc6a2 first appeared in SCOPe 2.03
  
• d2rc6a2 appears in SCOPe 2.06
  
• d2rc6a2 appears in the current release, SCOPe 2.08