![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) ![]() |
![]() | Family b.43.4.0: automated matches [227162] (1 protein) not a true family |
![]() | Protein automated matches [226870] (22 species) not a true protein |
![]() | Species Leptospira interrogans [TaxId:173] [225433] (2 PDB entries) |
![]() | Domain d2rc6a1: 2rc6 A:7-158 [206050] Other proteins in same PDB: d2rc6a2, d2rc6b2, d2rc6c2, d2rc6d2 automated match to d1qufa1 complexed with fad, nap, so4, zn |
PDB Entry: 2rc6 (more details), 2.7 Å
SCOPe Domain Sequences for d2rc6a1:
Sequence, based on SEQRES records: (download)
>d2rc6a1 b.43.4.0 (A:7-158) automated matches {Leptospira interrogans [TaxId: 173]} ptrepqinlfkksnpykakvisnvlltpetgtgkrpkkegealvhrivlaidhsaypyvi gqsggvippgedpekkakgladvgytvrlysiaspsysfgmkedniefiikrdniydeng niqfkgvcsnymcdlkpgdevtmtgpsgkkfl
>d2rc6a1 b.43.4.0 (A:7-158) automated matches {Leptospira interrogans [TaxId: 173]} ptrepqinlfkksnpykakvisnvlltpetgtgkrpkkegealvhrivlaidhsaypyvi gqsggvippgedpekkakgladvgytvrlysiaspsysfgmkedniefiikrdniyngni qfkgvcsnymcdlkpgdevtmtgpsgkkfl
Timeline for d2rc6a1: