Lineage for d2q32b_ (2q32 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1749970Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 1749971Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 1750205Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. 1750206Protein automated matches [190172] (8 species)
    not a true protein
  7. 1750212Species Human (Homo sapiens) [TaxId:9606] [225276] (4 PDB entries)
  8. 1750216Domain d2q32b_: 2q32 B: [205739]
    automated match to d1wova1
    complexed with oxn

Details for d2q32b_

PDB Entry: 2q32 (more details), 2.4 Å

PDB Description: crystal structure of human heme oxygenase-2 c127a (ho-2)
PDB Compounds: (B:) Heme oxygenase 2

SCOPe Domain Sequences for d2q32b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q32b_ a.132.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adlsellkegtkeahdraentqfvkdflkgnikkelfklattalyftysaleeemernkd
hpafaplyfpmelhrkealtkdmeyffgenweeqvqapkaaqkyverihyigqnepellv
ahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaqqfkqlyrarmnald
lnmktkeriveeankafeynmqifneldqagstlaret

SCOPe Domain Coordinates for d2q32b_:

Click to download the PDB-style file with coordinates for d2q32b_.
(The format of our PDB-style files is described here.)

Timeline for d2q32b_: