Lineage for d2pzmb1 (2pzm B:1-306)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107090Species Bordetella bronchiseptica [TaxId:518] [225344] (8 PDB entries)
  8. 2107097Domain d2pzmb1: 2pzm B:1-306 [205708]
    Other proteins in same PDB: d2pzma2, d2pzmb2
    automated match to d3enkb_
    complexed with nad, so4, udp

Details for d2pzmb1

PDB Entry: 2pzm (more details), 2 Å

PDB Description: Crystal structure of the Bordetella bronchiseptica enzyme WbmG in complex with NAD and UDP
PDB Compounds: (B:) Putative nucleotide sugar epimerase/ dehydratase

SCOPe Domain Sequences for d2pzmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pzmb1 c.2.1.0 (B:1-306) automated matches {Bordetella bronchiseptica [TaxId: 518]}
mrilitggagclgsnliehwlpqgheilvidnfatgkrevlppvaglsviegsvtdagll
erafdsfkpthvvhsaaaykdpddwaedaatnvqgsinvakaaskagvkrllnfqtalcy
grpatvpipidsptapftsygisktageaflmmsdvpvvslrlanvtgprlaigpiptfy
krlkagqkcfcsdtvrdfldmsdflaiadlslqegrptgvfnvstgeghsikevfdvvld
yvgatlaepvpvvapgaddvpsvvldpsktetefgwkakvdfkdtitgqlawydkygvtd
ifshls

SCOPe Domain Coordinates for d2pzmb1:

Click to download the PDB-style file with coordinates for d2pzmb1.
(The format of our PDB-style files is described here.)

Timeline for d2pzmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pzmb2