Lineage for d2p88f2 (2p88 F:126-369)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2445369Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2445853Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2445854Protein automated matches [226923] (78 species)
    not a true protein
  7. 2445895Species Bacillus cereus [TaxId:226900] [225290] (3 PDB entries)
  8. 2445903Domain d2p88f2: 2p88 F:126-369 [205472]
    Other proteins in same PDB: d2p88a1, d2p88b1, d2p88c1, d2p88d1, d2p88e1, d2p88f1, d2p88g1, d2p88h1
    automated match to d1nu5a1
    complexed with mg

Details for d2p88f2

PDB Entry: 2p88 (more details), 2.4 Å

PDB Description: Crystal structure of N-succinyl Arg/Lys racemase from Bacillus cereus ATCC 14579
PDB Compounds: (F:) mandelate racemase/muconate lactonizing enzyme family protein

SCOPe Domain Sequences for d2p88f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p88f2 c.1.11.0 (F:126-369) automated matches {Bacillus cereus [TaxId: 226900]}
ryheefpvthvlsiadpenmaeeaasmiqkgyqsfkmkvgtnvkedvkrieavrervgnd
iairvdvnqgwknsantltalrslghlnidwieqpviaddidamahirsktdlplmideg
lkssremrqiikleaadkvniklmkcggiypavklahqaemagiecqvgsmvessvassa
gfhvafskkiitsveltgplkftkdignlhydvpfirlnekpglgieinedtlqeltvfq
divr

SCOPe Domain Coordinates for d2p88f2:

Click to download the PDB-style file with coordinates for d2p88f2.
(The format of our PDB-style files is described here.)

Timeline for d2p88f2: