Lineage for d2p88c1 (2p88 C:1-125)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2554846Species Bacillus cereus [TaxId:226900] [225289] (3 PDB entries)
  8. 2554851Domain d2p88c1: 2p88 C:1-125 [205465]
    Other proteins in same PDB: d2p88a2, d2p88b2, d2p88c2, d2p88d2, d2p88e2, d2p88f2, d2p88g2, d2p88h2
    automated match to d1nu5a2
    complexed with mg

Details for d2p88c1

PDB Entry: 2p88 (more details), 2.4 Å

PDB Description: Crystal structure of N-succinyl Arg/Lys racemase from Bacillus cereus ATCC 14579
PDB Compounds: (C:) mandelate racemase/muconate lactonizing enzyme family protein

SCOPe Domain Sequences for d2p88c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p88c1 d.54.1.0 (C:1-125) automated matches {Bacillus cereus [TaxId: 226900]}
mkitaihlyairlplrnpfvisygsysdmpsiivkmetdegiigygegvaddhvtgeswe
stfhtlkhtltpaligqnpmniekihdmmdntiygvptakaaidiacfdimgkklnqpvy
qligg

SCOPe Domain Coordinates for d2p88c1:

Click to download the PDB-style file with coordinates for d2p88c1.
(The format of our PDB-style files is described here.)

Timeline for d2p88c1: