SCOPe 2.08: Domain d2p1pa1: 2p1p A:8-47

Lineage for d2p1pa1 (2p1p A:8-47)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225248] (4 PDB entries)

8. Domain d2p1pa1: 2p1p A:8-47 [205409]
   Other proteins in same PDB: d2p1pa2
   automated match to d2ovra2
   complexed with iac, ihp

Details for d2p1pa1

PDB Entry: 2p1p, 2.21 Å

PDB Description: mechanism of auxin perception by the tir1 ubiquitin ligase

PDB Compounds: (A:) SKP1-like protein 1A

SCOPe Domain Sequences for d2p1pa1:

Sequence, based on SEQRES records:

>d2p1pa1 d.42.1.0 (A:8-47) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lkssdgesfeveeavalesqtiahmveddcvdngvplpnv

Sequence, based on observed residues (ATOM records):

>d2p1pa1 d.42.1.0 (A:8-47) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lkssdgesfeveeavalesqtiavplpnv

Timeline for d2p1pa1:

• d2p1pa1 first appeared in SCOPe 2.03
  
• d2p1pa1 appears in SCOPe 2.07