Lineage for d2ofxb1 (2ofx B:24-227)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128604Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)
  8. 2128644Domain d2ofxb1: 2ofx B:24-227 [205265]
    Other proteins in same PDB: d2ofxa2, d2ofxb2
    automated match to d1m7gc_
    complexed with adp, mg, po4, pps

Details for d2ofxb1

PDB Entry: 2ofx (more details), 1.9 Å

PDB Description: crystal structure of the APSK domain of human PAPSS1 in complex with ADPMg and PAPS
PDB Compounds: (B:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1

SCOPe Domain Sequences for d2ofxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ofxb1 c.37.1.0 (B:24-227) automated matches {Human (Homo sapiens) [TaxId: 9606]}
matnvtyqahhvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchgipc
ytldgdnirqglnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnar
qihegaslpffevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlk
tdscdvndcvqqvvellqerdivp

SCOPe Domain Coordinates for d2ofxb1:

Click to download the PDB-style file with coordinates for d2ofxb1.
(The format of our PDB-style files is described here.)

Timeline for d2ofxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ofxb2