SCOPe 2.06: Domain d2o72a2: 2o72 A:102-213

Lineage for d2o72a2 (2o72 A:102-213)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.1: Cadherin [49314] (4 proteins)

6. Protein E-cadherin (epithelial) [49317] (2 species)
   synonym: uvomorulin

7. Species Human (Homo sapiens) [TaxId:9606] [81981] (12 PDB entries)

8. Domain d2o72a2: 2o72 A:102-213 [205236]
   automated match to d1ncja2
   complexed with ca

Details for d2o72a2

PDB Entry: 2o72, 2 Å

PDB Description: crystal structure analysis of human e-cadherin (1-213)

PDB Compounds: (A:) epithelial-cadherin

SCOPe Domain Sequences for d2o72a2:

Sequence; same for both SEQRES and ATOM records:

>d2o72a2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]}
ndnkpeftqevfkgsvmegalpgtsvmevtatdadddvntynaaiaytilsqdpelpdkn
mftinrntgvisvvttgldresfptytlvvqaadlqgeglsttatavitvtd

Timeline for d2o72a2:

• d2o72a2 first appeared in SCOPe 2.03
  
• d2o72a2 appears in SCOPe 2.05
  
• d2o72a2 appears in SCOPe 2.07
  
• d2o72a2 appears in the current release, SCOPe 2.08