Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (7 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:273057] [225354] (3 PDB entries) |
Domain d2ntic1: 2nti C:1-126 [205164] automated match to d1ud9a1 complexed with 7pg, br, k |
PDB Entry: 2nti (more details), 2.5 Å
SCOPe Domain Sequences for d2ntic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ntic1 d.131.1.0 (C:1-126) automated matches {Sulfolobus solfataricus [TaxId: 273057]} mkvvyddvrvlkdiiqalarlvdeavlkfkqdsvelvaldrahislisvnlpremfkeyd vndefkfgfntqylmkilkvakrkeaieiasespdsviiniigstnrefnvrnlevseqe ipeinl
Timeline for d2ntic1: