Lineage for d2ntib2 (2nti B:128-245)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431831Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1431832Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 1432176Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 1432177Protein automated matches [226907] (7 species)
    not a true protein
  7. 1432203Species Sulfolobus solfataricus [TaxId:273057] [225354] (3 PDB entries)
  8. 1432213Domain d2ntib2: 2nti B:128-245 [205163]
    automated match to d1ud9a2
    complexed with 7pg, br, k

Details for d2ntib2

PDB Entry: 2nti (more details), 2.5 Å

PDB Description: crystal structure of pcna123 heterotrimer.
PDB Compounds: (B:) DNA polymerase sliding clamp c

SCOPe Domain Sequences for d2ntib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ntib2 d.131.1.0 (B:128-245) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
efpfkaqlltitfadiidelsdlgevlnihskenklyfevigdlstakvelstdngtlle
asgadvsssygmeyvanttkmrrasdsmelyfgsqiplklrfklpqegygdfyiapra

SCOPe Domain Coordinates for d2ntib2:

Click to download the PDB-style file with coordinates for d2ntib2.
(The format of our PDB-style files is described here.)

Timeline for d2ntib2: