SCOPe 2.04: Domain d2jjta_: 2jjt A:

Lineage for d2jjta_ (2jjt A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d2jjta_: 2jjt A: [205064]
   automated match to d2i26o_
   complexed with nag

Details for d2jjta_

PDB Entry: 2jjt, 2.3 Å

PDB Description: structure of human cd47 in complex with human signal regulatory protein (sirp) alpha

PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type substrate 1

SCOPe Domain Sequences for d2jjta_:

Sequence; same for both SEQRES and ATOM records:

>d2jjta_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elqviqpdksvsvaagesailhctvtslipvgpiqwfrgagpareliynqkeghfprvtt
vsestkrenmdfsisisnitpadagtyycvkfrkgspdtefksgagtelsvra

Timeline for d2jjta_:

• d2jjta_ first appeared in SCOPe 2.03
  
• d2jjta_ appears in SCOPe 2.05
  
• d2jjta_ appears in the current release, SCOPe 2.08